PDB entry 3dab

View 3dab on RCSB PDB site
Description: Structure of the human Mdmx protein bound to the p53 tumor suppressor transactivation domain
Class: cell cycle
Keywords: MDMX, MDM4, HDMX, HDM4, MDM-4, MDM-X, MDM2, HDM2, P53, tumor, nucleus, oncogene, apoptosis, cell cycle, disease mutation, DNA-binding, transcription
Deposited on 2008-05-29, released 2008-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mdm4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: mdm4, mdmx
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15151 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.08: d3daba1, d3daba2
  • Chain 'B':
    Compound: Cellular tumor antigen p53
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: mdm4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: mdm4, mdmx
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15151 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.08: d3dabc1, d3dabc2
  • Chain 'D':
    Compound: Cellular tumor antigen p53
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: mdm4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: mdm4, mdmx
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15151 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.08: d3dabe1, d3dabe2
  • Chain 'F':
    Compound: Cellular tumor antigen p53
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: mdm4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: mdm4, mdmx
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15151 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.08: d3dabg1, d3dabg2
  • Chain 'H':
    Compound: Cellular tumor antigen p53
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dabA (A:)
    iqinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdll
    gellgrqsfsvkdpsplydmlrknlvtlat
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dabA (A:)
    iqinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdll
    gellgrqsfsvkdpsplydmlrknlvtl
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dabC (C:)
    iqinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdll
    gellgrqsfsvkdpsplydmlrknlvtlat
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dabC (C:)
    iqinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdll
    gellgrqsfsvkdpsplydmlrknlv
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3dabE (E:)
    iqinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdll
    gellgrqsfsvkdpsplydmlrknlvtlat
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dabE (E:)
    iqinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdll
    gellgrqsfsvkdpsplydmlrknlv
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3dabG (G:)
    iqinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdll
    gellgrqsfsvkdpsplydmlrknlvtlat
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dabG (G:)
    iqinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdll
    gellgrqsfsvkdpsplydmlrknlvtl
    

  • Chain 'H':
    No sequence available.