PDB entry 3da0

View 3da0 on RCSB PDB site
Description: Crystal structure of a cleaved form of a chimeric receptor binding protein from Lactococcal phages subspecies TP901-1 and p2
Class: viral protein
Keywords: lactococcal phage p2, lactococcal phage TP901-1 receptor binding protein, VIRAL PROTEIN
Deposited on 2008-05-28, released 2009-06-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.165
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cleaved chimeric receptor binding protein from bacteriophages TP901-1 and p2
    Species: Lactococcus phage TP901-1, Lactococcus lactis phage p2 [TaxId:35345, 100641]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3da0a1, d3da0a2
  • Chain 'B':
    Compound: Cleaved chimeric receptor binding protein from bacteriophages TP901-1 and p2
    Species: Lactococcus phage TP901-1, Lactococcus lactis phage p2 [TaxId:35345, 100641]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9G096 (Start-30)
    • Uniprot Q71AW2 (31-132)
      • expression tag (133-135)
    Domains in SCOPe 2.06: d3da0b1, d3da0b2, d3da0b3
  • Chain 'C':
    Compound: Cleaved chimeric receptor binding protein from bacteriophages TP901-1 and p2
    Species: Lactococcus phage TP901-1, Lactococcus lactis phage p2 [TaxId:35345, 100641]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3da0c1, d3da0c2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3da0A (A:)
    gnvvhktgdetiagkktftgnvevngsltlpvqtltveagnglqlqltkknndlvivrff
    gsvsniqkgwnmsgtwvdrpfrpaavqslvghfagrdtsfhidinpngsitwwganidkt
    piatrgngsyfikhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3da0A (A:)
    nvvhktgdetiagkktftgnvevngsltlpvqtltveagnglqlqltkknndlvivrffg
    svsniqkgwnmsgtwvdrpfrpaavqslvghfagrdtsfhidinpngsitwwganidktp
    iatrgngsyfik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3da0B (B:)
    gnvvhktgdetiagkktftgnvevngsltlpvqtltveagnglqlqltkknndlvivrff
    gsvsniqkgwnmsgtwvdrpfrpaavqslvghfagrdtsfhidinpngsitwwganidkt
    piatrgngsyfikhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3da0B (B:)
    nvvhktgdetiagkktftgnvevngsltlpvqtltveagnglqlqltkknndlvivrffg
    svsniqkgwnmsgtwvdrpfrpaavqslvghfagrdtsfhidinpngsitwwganidktp
    iatrgngsyfikhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3da0C (C:)
    gnvvhktgdetiagkktftgnvevngsltlpvqtltveagnglqlqltkknndlvivrff
    gsvsniqkgwnmsgtwvdrpfrpaavqslvghfagrdtsfhidinpngsitwwganidkt
    piatrgngsyfikhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3da0C (C:)
    gnvvhktgdetiagkktftgnvevngsltlpvqtltveagnglqlqltkknndlvivrff
    gsvsniqkgwnmsgtwvdrpfrpaavqslvghfagrdtsfhidinpngsitwwganidkt
    piatrgngsyfik