PDB entry 3d9u

View 3d9u on RCSB PDB site
Description: The BIR3 domain of cIAP1 in complex with the N terminal peptide from SMAC/DIABLO (AVPIAQ).
Class: apoptosis
Keywords: zinc finger, Apoptosis, Cytoplasm, Metal-binding, Polymorphism, Zinc, Zinc-finger
Deposited on 2008-05-27, released 2008-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-10, with a file datestamp of 2009-02-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.207
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Baculoviral IAP repeat-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BIRC2, API1, IAP2, MIHB, RNF48
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3d9ua1
  • Chain 'B':
    Compound: smac/diablo
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3D9U (0-5)
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3d9uA (A:)
gpgssisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrc
wesgddpwvehakwfprceflirmkgqefvdeiqgry

    Sequence, based on observed residues (ATOM records): (download) 
    >3d9uA (A:)
sisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesg
ddpwvehakwfprceflirmkgqefvdeiqgr

  • Chain 'B':
    No sequence available.