PDB entry 3d9j

View 3d9j on RCSB PDB site
Description: Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of the Carboxy-Terminal Domain of RNA-Polymerase II
Class: transcription
Keywords: SCAF8, RNA POLYMERASE II CTD INTERACTING DOMAIN, ARM REPEATS, PHOSPHO-CTD, Phosphoprotein, RNA-binding, Transcription
Deposited on 2008-05-27, released 2008-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein 16
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM16, KIAA1116
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UPN6 (Start-135)
      • expression tag (136-137)
    Domains in SCOPe 2.07: d3d9ja1, d3d9ja2
  • Chain 'B':
    Compound: RNA-binding protein 16
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM16, KIAA1116
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UPN6 (Start-135)
      • expression tag (136-140)
    Domains in SCOPe 2.07: d3d9jb1, d3d9jb2
  • Heterogens: NH4, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d9jA (A:)
    meavktfnselyslndykppiskakmtqitkaaikaikfykhvvqsvekfiqkckpeykv
    pglyvidsivrqsrhqfgqekdvfaprfsnniistfqnlyrcpgddkskivrvlnlwqkn
    nvfkseiiqplldmaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d9jA (A:)
    eavktfnselyslndykppiskakmtqitkaaikaikfykhvvqsvekfiqkckpeykvp
    glyvidsivrqsrhqfgqekdvfaprfsnniistfqnlyrcpgddkskivrvlnlwqknn
    vfkseiiqplldmaaal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d9jB (B:)
    meavktfnselyslndykppiskakmtqitkaaikaikfykhvvqsvekfiqkckpeykv
    pglyvidsivrqsrhqfgqekdvfaprfsnniistfqnlyrcpgddkskivrvlnlwqkn
    nvfkseiiqplldmaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d9jB (B:)
    eavktfnselyslndykppiskakmtqitkaaikaikfykhvvqsvekfiqkckpeykvp
    glyvidsivrqsrhqfgqekdvfaprfsnniistfqnlyrcpgddkskivrvlnlwqknn
    vfkseiiqplldmaaalehh