PDB entry 3d9f

View 3d9f on RCSB PDB site
Description: Nitroalkane oxidase: active site mutant S276A crystallized with 1-nitrohexane
Class: oxidoreductase
Keywords: oxidoreductase, flavoenzyme, nitroalkane, acyl-coa dehydrogenase, long cell edge, fad, inhibitor, flavoprotein
Deposited on 2008-05-27, released 2009-04-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-23, with a file datestamp of 2014-04-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.202
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitroalkane oxidase
    Species: FUSARIUM OXYSPORUM [TaxId:5507]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8X1D8 (0-End)
      • engineered (274)
    Domains in SCOPe 2.07: d3d9fa1, d3d9fa2
  • Chain 'B':
    Compound: nitroalkane oxidase
    Species: FUSARIUM OXYSPORUM [TaxId:5507]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8X1D8 (0-End)
      • engineered (274)
    Domains in SCOPe 2.07: d3d9fb1, d3d9fb2
  • Chain 'C':
    Compound: nitroalkane oxidase
    Species: FUSARIUM OXYSPORUM [TaxId:5507]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8X1D8 (0-End)
      • engineered (274)
    Domains in SCOPe 2.07: d3d9fc1, d3d9fc2
  • Chain 'D':
    Compound: nitroalkane oxidase
    Species: FUSARIUM OXYSPORUM [TaxId:5507]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8X1D8 (0-End)
      • engineered (274)
    Domains in SCOPe 2.07: d3d9fd1, d3d9fd2
  • Heterogens: FAD, N6C, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d9fA (A:)
    vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
    vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
    sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
    dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
    gphtrftefhvphenllctpglkaqglvetafamaaalvgamaigtaraafeealvfaks
    dtrggskhiiehqsvadklidckirletsrllvwkavttledealewkvklemamqtkiy
    ttdvavecvidamkavgmksyakdmsfprllnevmcyplfdggniglrrrqmqrvmaled
    yepwaatygsskvdksrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d9fA (A:)
    vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
    vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
    sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
    dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
    gphtrftefhvphenllctpglkaqglvetafamaaalvgamaigtaraafeealvfaks
    dtrggskhiiehqsvadklidckirletsrllvwkavttledealewkvklemamqtkiy
    ttdvavecvidamkavgmksyakdmsfprllnevmcyplfdggniglrrrqmqrvmaled
    yepwaatygss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d9fB (B:)
    vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
    vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
    sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
    dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
    gphtrftefhvphenllctpglkaqglvetafamaaalvgamaigtaraafeealvfaks
    dtrggskhiiehqsvadklidckirletsrllvwkavttledealewkvklemamqtkiy
    ttdvavecvidamkavgmksyakdmsfprllnevmcyplfdggniglrrrqmqrvmaled
    yepwaatygsskvdksrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d9fB (B:)
    vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
    vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
    sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
    dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
    gphtrftefhvphenllctpglkaqglvetafamaaalvgamaigtaraafeealvfaks
    dtrggskhiiehqsvadklidckirletsrllvwkavttledealewkvklemamqtkiy
    ttdvavecvidamkavgmksyakdmsfprllnevmcyplfdggniglrrrqmqrvmaled
    yepwaatygss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3d9fC (C:)
    vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
    vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
    sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
    dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
    gphtrftefhvphenllctpglkaqglvetafamaaalvgamaigtaraafeealvfaks
    dtrggskhiiehqsvadklidckirletsrllvwkavttledealewkvklemamqtkiy
    ttdvavecvidamkavgmksyakdmsfprllnevmcyplfdggniglrrrqmqrvmaled
    yepwaatygsskvdksrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d9fC (C:)
    vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
    vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
    sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
    dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
    gphtrftefhvphenllctpglkaqglvetafamaaalvgamaigtaraafeealvfaks
    dtrggskhiiehqsvadklidckirletsrllvwkavttledealewkvklemamqtkiy
    ttdvavecvidamkavgmksyakdmsfprllnevmcyplfdggniglrrrqmqrvmaled
    yepwaatygs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3d9fD (D:)
    vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
    vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
    sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
    dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
    gphtrftefhvphenllctpglkaqglvetafamaaalvgamaigtaraafeealvfaks
    dtrggskhiiehqsvadklidckirletsrllvwkavttledealewkvklemamqtkiy
    ttdvavecvidamkavgmksyakdmsfprllnevmcyplfdggniglrrrqmqrvmaled
    yepwaatygsskvdksrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d9fD (D:)
    vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
    vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
    sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
    dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
    gphtrftefhvphenllctpglkaqglvetafamaaalvgamaigtaraafeealvfaks
    dtrggskhiiehqsvadklidckirletsrllvwkavttledealewkvklemamqtkiy
    ttdvavecvidamkavgmksyakdmsfprllnevmcyplfdggniglrrrqmqrvmaled
    yepwaatygs