PDB entry 3d90

View 3d90 on RCSB PDB site
Description: Crystal structure of the human progesterone receptor ligand-binding domain bound to levonorgestrel
Class: transcription
Keywords: progesterone receptor, steroid receptor, nuclear receptor, transcription factor, women health, contraception, Alternative splicing, DNA-binding, Lipid-binding, Metal-binding, Nucleus, Phosphoprotein, Polymorphism, Receptor, Steroid-binding, Transcription, Transcription regulation, Zinc, Zinc-finger
Deposited on 2008-05-26, released 2009-05-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-06-02, with a file datestamp of 2009-05-29.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.231
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: progesterone receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: PGR, NR3C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3d90a_
  • Chain 'B':
    Compound: progesterone receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: PGR, NR3C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3d90b_
  • Heterogens: NOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d90A (A:)
    spgqdiqlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwsks
    lpgfrnlhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfy
    slcltmwqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelika
    iglrqkgvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaa
    qlpkilagmvkpllfhkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d90A (A:)
    qlipplinllmsiepdviyaghdnpdtssslltslnqlgerqllsvvkwskslpgfrnlh
    iddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmwq
    ipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqgvv
    sssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkilagm
    vkpllfh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d90B (B:)
    spgqdiqlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwsks
    lpgfrnlhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfy
    slcltmwqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelika
    iglrqkgvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaa
    qlpkilagmvkpllfhkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d90B (B:)
    lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
    hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
    qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqgv
    vsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkilag
    mvkpllfhk