PDB entry 3d8v

View 3d8v on RCSB PDB site
Description: Crystal structure of GlmU from Mycobacterium tuberculosis in complex with uridine-diphosphate-N-acetylglucosamine
Class: transferase
Keywords: Nucleotide-diphospho-sugar transferases/Single-stranded left-handed beta-helix, Acyltransferase, Cell shape, Cell wall biogenesis/degradation, Cytoplasm, Magnesium, Metal-binding, Multifunctional enzyme, Nucleotidyltransferase, Peptidoglycan synthesis
Deposited on 2008-05-25, released 2009-03-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-10, with a file datestamp of 2009-03-06.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.201
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein glmU
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glmU, Rv1018c, MT1046
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d8va1, d3d8va2
  • Heterogens: UD1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d8vA (A:)
    mtfpgdtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrlivvlghdh
    qriaplvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgdtpllda
    dtladliathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsqreirev
    nagvyafdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsalvagvnn
    rvqlaelaselnrrvvaahqlagvtvvdpattwidvdvtigrdtvihpgtqllgrtqigg
    rcvvgpdttltdvavgdgasvvrthgssssigdgaavgpftylrpgtalgadgklgafve
    vknstigtgtkvphltyvgdadigeysnigassvfvnydgtskrrttvgshvrtgsdtmf
    vapvtigdgaytgagtvvredvppgalavsagpqrnienwvqrkrpgspaaqaskrasem
    acqqptqppdadqtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d8vA (A:)
    mtfpgdtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrlivvlghdh
    qriaplvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgdtpllda
    dtladliathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsqreirev
    nagvyafdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsalvagvnn
    rvqlaelaselnrrvvaahqlagvtvvdpattwidvdvtigrdtvihpgtqllgrtqigg
    rcvvgpdttltdvavgdgasvvrthgssssigdgaavgpftylrpgtalgadgklgafve
    vknstigtgtkvphltyvgdadigeysnigassvfvnydtskrrttvgshvrtgsdtmfv
    apvtigdgaytgagtvvredvppgalavsagpqrnienwvqrkrpgspaaqaskrase