PDB entry 3d8g

View 3d8g on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS I72R at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, hydrolase, internal arg, Endonuclease, Metal-binding, Nuclease, Secreted, Zymogen
Deposited on 2008-05-23, released 2009-01-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.205
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus subsp. aureus MW2 [TaxId:196620]
    Gene: nuc, MW0769
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NXI6
      • engineered (43-44)
      • engineered (65)
      • engineered (110)
      • engineered (121)
    Domains in SCOPe 2.06: d3d8ga_
  • Heterogens: CA, THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d8gA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmv
    enakkrevefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d8gA (A:)
    lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakkr
    evefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
    kkeklniwse