PDB entry 3d84

View 3d84 on RCSB PDB site
Description: Structural Analysis of a Holo Enzyme Complex of Mouse Dihydrofolate Reductase with NADPH and a Ternary Complex with the Potent and Selective Inhibitor 2.4-Diamino-6-(-2'-hydroxydibenz[b,f]azepin-5-yl)methylpteridine
Class: oxidoreductase
Keywords: mouse DHFR holo enzyme and ternary ligand complex, NADP, One-carbon metabolism, Oxidoreductase
Deposited on 2008-05-22, released 2008-09-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: dihydrofolate reductase
    Species: Mus musculus [TaxId:10090]
    Gene: Dhfr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3d84x_
  • Heterogens: NDP, GOL, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d84X (X:)
    vrplncivavsqnmgigkngdlpwpplrnefkyfqrmtttssvegkqnlvimgrktwfsi
    peknrplkdrinivlsrelkepprgahflakslddalrlieqpelaskvdmvwivggssv
    yqeamnqpghlrlfvtrimqefesdtffpeidlgkykllpeypgvlsevqeekgikykfe
    vyekkd