PDB entry 3d81

View 3d81 on RCSB PDB site
Description: Sir2-S-alkylamidate complex crystal structure
Class: hydrolase
Keywords: Rossmann fold, NAD dependent deacetylase, Cytoplasm, Hydrolase, Metal-binding, NAD, Zinc
Deposited on 2008-05-22, released 2008-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent deacetylase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: npdA, TM_0490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d81a_
  • Chain 'C':
    Compound: S-alkylamidate intermediate
    Database cross-references and differences (RAF-indexed):
    • PDB 3D81 (0-7)
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d81A (A:)
    mkmkefldllnesrltvtltgagistpsgipdfrgpngiykkysqnvfdidffyshpeef
    yrfakegifpmlqakpnlahvllakleekglieavitqnidrlhqragskkvielhgnve
    eyycvrcekkytvedvikklessdvplcddcnslirpnivffgenlpqdalreaiglssr
    aslmivlgsslvvypaaelplitvrsggklvivnlgetpfddiatlkynmdvvefarrvm
    eeggis
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d81A (A:)
    mkmkefldllnesrltvtltgagistpsgipdfqnvfdidffyshpeefyrfakegifpm
    lqakpnlahvllakleekglieavitqnidrlhqragskkvielhgnveeyycvrcekky
    tvedvikklessdvplcddcnslirpnivffgenlpqdalreaiglssraslmivlgssl
    vvypaaelplitvrsggklvivnlgetpfddiatlkynmdvvefarrvmeeggis
    

  • Chain 'C':
    No sequence available.