PDB entry 3d80

View 3d80 on RCSB PDB site
Description: Structural Analysis of a Holo Enzyme Complex of Mouse Dihydrofolate Reductase with NADPH and a Ternary Complex wtih the Potent and Selective Inhibitor 2,4-Diamino-6-(2'-hydroxydibenz[b,f]azepin-5-yl)methylpteridine
Class: oxidoreductase
Keywords: mouse holo enzyme ternary ligand complex dihydrofolate reductase, NADP, One-carbon metabolism, Oxidoreductase
Deposited on 2008-05-22, released 2008-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-12, with a file datestamp of 2013-06-07.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.201
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrofolate reductase
  Species: Mus musculus [TaxId:10090]
  Gene: Dhfr
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00375 (0-185)
  Domains in SCOPe 2.07: d3d80a_
• Heterogens: NDP, Q22, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3d80A (A:)
  vrplncivavsqnmgigkngdlpwpplrnefkyfqrmtttssvegkqnlvimgrktwfsi
  peknrplkdrinivlsrelkepprgahflakslddalrlieqpelaskvdmvwivggssv
  yqeamnqpghlrlfvtrimqefesdtffpeidlgkykllpeypgvlsevqeekgikykfe
  vyekkd