PDB entry 3d7v

View 3d7v on RCSB PDB site
Description: Crystal structure of Mcl-1 in complex with an Mcl-1 selective BH3 ligand
Class: apoptosis
Keywords: helical bundle, amphipathic helix, Alternative splicing, Apoptosis, Cytoplasm, Developmental protein, Differentiation, Membrane, Mitochondrion, Nucleus, Phosphoprotein, Polymorphism, Transmembrane, Ubl conjugation
Deposited on 2008-05-22, released 2008-06-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.194
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Induced myeloid leukemia cell differentiation protein Mcl-1
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Gene: MCL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3d7va_
  • Chain 'B':
    Compound: Bcl-2-like protein 11
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43521
      • engineered (11)
      • engineered (18)
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3d7vA (A:)
gplgseddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhe
tafqgmlrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqes
cieplaesitdvlvrtkrdwlvkqrgwdgfveffhvedlegg

    Sequence, based on observed residues (ATOM records): (download) 
    >3d7vA (A:)
ddlyrqsleiisrylreqatgskdgaagrraletlrrvgdgvqrnhetafqgmlrkldik
neddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqescieplaesitdvl
vrtkrdwlvkqrgwdgfveffhve

  • Chain 'B':
    No sequence available.