PDB entry 3d7c

View 3d7c on RCSB PDB site
Description: Crystal structure of the bromodomain of human GCN5, the general control of amino-acid synthesis protein 5-like 2
Class: transcription
Keywords: GCN5, bromodomain, amino-acid synthesis, Structural Genomics Consortium, SGC, Host-virus interaction, Nucleus, Phosphoprotein, Transcription, Transcription regulation, Transferase, BIOSYNTHETIC PROTEIN
Deposited on 2008-05-21, released 2008-07-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.183
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: General control of amino acid synthesis protein 5-like 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GCN5L2, GCN5, HGCN5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92830 (3-111)
      • expression tag (1-2)
    Domains in SCOPe 2.02: d3d7ca_
  • Chain 'B':
    Compound: General control of amino acid synthesis protein 5-like 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GCN5L2, GCN5, HGCN5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3d7cb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3d7cA (A:)
smedpdqlyttlknllaqikshpsawpfmepvkkseapdyyevirfpidlktmterlrsr
yyvtrklfvadlqrviancreynppdseycrcasalekffyfklkegglidk

    Sequence, based on observed residues (ATOM records): (download) 
    >3d7cA (A:)
medpdqlyttlknllaqikshpsawpfmepvkkseapdyyevirfpidlktmterlrsry
yvtrklfvadlqrviancreynppdseycrcasalekffyfklkegglidk

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3d7cB (B:)
smedpdqlyttlknllaqikshpsawpfmepvkkseapdyyevirfpidlktmterlrsr
yyvtrklfvadlqrviancreynppdseycrcasalekffyfklkegglidk

    Sequence, based on observed residues (ATOM records): (download) 
    >3d7cB (B:)
pdqlyttlknllaqikshpsawpfmepvkkseapdyyevirfpidlktmterlrsryyvt
rklfvadlqrviancreynppdseycrcasalekffyfklkeggli