PDB entry 3d76

View 3d76 on RCSB PDB site
Description: Crystal structure of a pheromone binding protein mutant D35N, from Apis mellifera, soaked at pH 7.0
Class: Pheromone binding protein
Keywords: Pheromone binding protein, Honey bee, Apis mellifera, signal transduction, queen mandibular protein, pH
Deposited on 2008-05-20, released 2009-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-28, with a file datestamp of 2009-07-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pheromone-binding protein ASP1
    Species: Apis mellifera [TaxId:7460]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U9J6 (Start-118)
      • engineered (34)
    Domains in SCOPe 2.07: d3d76a_
  • Heterogens: NA, NBB, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d76A (A:)
    apdwvppevfdlvaedkarcmsehgttqaqiddvnkgnlvnepsitcymyclleafslvd
    deanvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d76A (A:)
    wvppevfdlvaedkarcmsehgttqaqiddvnkgnlvnepsitcymyclleafslvddea
    nvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi