PDB entry 3d73
View 3d73 on RCSB PDB site
Description: Crystal structure of a pheromone binding protein mutant D35A, from Apis mellifera, at pH 7.0
Class: Pheromone Binding Protein
Keywords: Pheromone binding protein, Honey bee, Apis mellifera, signal transduction, queen mandibular protein, pH
Deposited on
2008-05-20, released
2009-05-26
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-07-28, with a file datestamp of
2009-07-24.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.175
AEROSPACI score: 0.46
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Pheromone-binding protein ASP1
Species: Apis mellifera [TaxId:7460]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3d73a_ - Chain 'B':
Compound: Pheromone-binding protein ASP1
Species: Apis mellifera [TaxId:7460]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3d73b_ - Heterogens: NBB, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3d73A (A:)
apdwvppevfdlvaedkarcmsehgttqaqiddvakgnlvnepsitcymyclleafslvd
deanvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3d73B (B:)
apdwvppevfdlvaedkarcmsehgttqaqiddvakgnlvnepsitcymyclleafslvd
deanvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi