PDB entry 3d73

View 3d73 on RCSB PDB site
Description: Crystal structure of a pheromone binding protein mutant D35A, from Apis mellifera, at pH 7.0
Class: Pheromone Binding Protein
Keywords: Pheromone binding protein, Honey bee, Apis mellifera, signal transduction, queen mandibular protein, pH
Deposited on 2008-05-20, released 2009-05-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-07-28, with a file datestamp of 2009-07-24.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.175
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pheromone-binding protein ASP1
    Species: Apis mellifera [TaxId:7460]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U9J6 (0-118)
      • engineered (34)
    Domains in SCOPe 2.08: d3d73a_
  • Chain 'B':
    Compound: Pheromone-binding protein ASP1
    Species: Apis mellifera [TaxId:7460]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U9J6 (0-118)
      • engineered (34)
    Domains in SCOPe 2.08: d3d73b_
  • Heterogens: NBB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d73A (A:)
    apdwvppevfdlvaedkarcmsehgttqaqiddvakgnlvnepsitcymyclleafslvd
    deanvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d73B (B:)
    apdwvppevfdlvaedkarcmsehgttqaqiddvakgnlvnepsitcymyclleafslvd
    deanvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi