PDB entry 3d72

View 3d72 on RCSB PDB site
Description: 1.65 angstrom crystal structure of the cys71val variant in the fungal photoreceptor vvd
Deposited on 2008-05-20, released 2008-06-17
The last revision was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vivid PAS protein VVD
    Species: Neurospora crassa
    Gene: vvd, G17A4.050
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9C3Y6 (1-148)
      • initiating methionine (0)
      • engineered mutation (35)
  • Chain 'B':
    Compound: Vivid PAS protein VVD
    Species: Neurospora crassa
    Gene: vvd, G17A4.050
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9C3Y6 (1-148)
      • initiating methionine (0)
      • engineered mutation (35)
  • Heterogens: FAD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3d72A (A:)
mhtlyapggydimgyliqimnrpnpqvelgpvdtsvalilcdlkqkdtpivyaseaflym
tgysnaevlgrncrflqspdgmvkpkstrkyvdsntintmrkaidrnaevqvevvnfkkn
gqrfvnfltmipvrdetgeyrysmgfqce

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3d72B (B:)
mhtlyapggydimgyliqimnrpnpqvelgpvdtsvalilcdlkqkdtpivyaseaflym
tgysnaevlgrncrflqspdgmvkpkstrkyvdsntintmrkaidrnaevqvevvnfkkn
gqrfvnfltmipvrdetgeyrysmgfqce