PDB entry 3d70

View 3d70 on RCSB PDB site
Description: Crystal structure of E253A mutant of BMRR bound to 22-bp oligonucleotide
Class: transcription regulator/DNA
Keywords: MULTIDRUG RESISTANCE, TRANSCRIPTION REGULATION, PROTEIN-DNA COMPLEX, Activator, DNA-binding, TRANSCRIPTION REGULATOR-DNA COMPLEX
Deposited on 2008-05-20, released 2008-08-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.234
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BMR promoter DNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39075
      • engineered (252)
      • engineered (276)
    Domains in SCOPe 2.06: d3d70a1, d3d70a2, d3d70a3
  • Chain 'B':
    Compound: Multidrug-efflux transporter 1 regulator
    Species: Bacillus subtilis
    Gene: bmrR, bmr1R
  • Heterogens: IMD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d70A (A:)
    mkesyysigevsklanvsikalryydkidlfkpayvdpdtsyryytdsqlihldlikslk
    yigtpleemkkaqdlemeelfafyteqerqirekldflsaleqtislvkkrmkrqmeypa
    lgevfvldeeeiriiqteaegigpenvlnasysklkkfiesadgftnnsygatfsfqpyt
    sidemtyrhiftpvltnkqissitpdmeittipkgryaciaynfspehyflnlqklikyi
    adrqltvvsdvyaliipihyspkkqeeyrvemkirildhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d70A (A:)
    kesyysigevsklanvsikalryydkidlfkpayvdpdtsyryytdsqlihldlikslky
    igtpleemkkaqdlemeelfafyteqerqirekldflsaleqtislvkkrmkrqmeypal
    gevfvldeeeiriiqteaegigpenvlnasysklkkfiesadgftnnsygatfsfqpyts
    idemtyrhiftpvltnkqissitpdmeittipkgryaciaynfspehyflnlqklikyia
    drqltvvsdvyaliipihyspkkqeeyrvemkiril
    

  • Chain 'B':
    No sequence available.