PDB entry 3d6t

View 3d6t on RCSB PDB site
Description: Structure of the ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric GTPase
Class: transferase
Keywords: parkinson's disease, LRRK2, Roc, GTPase, Roco, Kinase, ATP-binding, Disease Mutation, GTP-binding, GTPase activation, Leucine-rich repeat, membrane, nucleotide-binding, parkinson disease, serine/threonine-protein kinase, transferase
Deposited on 2008-05-20, released 2008-06-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: 0.216
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'B':
  Compound: Leucine-rich repeat serine/threonine-protein kinase 2
  Species: Homo sapiens
  Gene: LRRK2, PARK8
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5S007 (1-170)
    • initiating methionine (0)
  Domains in SCOPe 2.05: d3d6tb_
• Heterogens: MG, GDP, HOH

PDB Chain Sequences:

• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >3d6tB (B:)
  mklmivgntgsgkttllqqlmktkksdlgmqsatvgidvkdwpiqirdkrkrdlvlnvwd
  fagreefysthphfmtqralylavydlskgqaevdamkpwlfnikarassspvilvgthl
  dvsdekqrkacmskitkellnkrgfpairdyhfvnateesdalaklrktii
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3d6tB (B:)
  mklmivgntgsgkttllqlmgidvkdwplvlvwdfagreefysthphfmtqralylavyd
  lskgqaevdamkpwlfnikarassspvilvgthldvsdkillgfpairdyhfvnateesl
  rktii