PDB entry 3d6n

View 3d6n on RCSB PDB site
Description: Crystal Structure of Aquifex Dihydroorotase Activated by Aspartate Transcarbamoylase
Class: hydrolase/transferase
Keywords: REACTOR, CHAMBER, PORES, INTERNAL CAVITY, Hydrolase, Metal-binding, Pyrimidine biosynthesis, Transferase, HYDROLASE-TRANSFERASE COMPLEX
Deposited on 2008-05-20, released 2009-01-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.166
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroorotase
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: pyrC, aq_806
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: aspartate carbamoyltransferase
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: pyrB, aq_409
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3d6nb1, d3d6nb2
  • Heterogens: ZN, FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3d6nB (B:)
mrslissldltreeveeilkyakefkegkeetikasavlffsepstrtrlsfekaarelg
ietylvsgsesstvkgesffdtlktfeglgfdyvvfrvpfvffpykeivkslnlrlvnag
dgthqhpsqglidfftikehfgevkdlrvlyvgdikhsrvfrsgapllnmfgakigvcgp
ktliprdvevfkvdvfddvdkgidwadvviwlrlqkerqkenyipsessyfkqfgltker
fekvklymhpgpvnrnvdidhelvyteksliqeqvkngipvrkaiykflwt