PDB entry 3d6c

View 3d6c on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant PHS L38E at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, hydrolase, Calcium, Endonuclease, Metal-binding, Secreted, Zymogen
Deposited on 2008-05-19, released 2008-11-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered (37)
      • engineered (116)
      • engineered (123)
      • engineered (127)
    Domains in SCOPe 2.05: d3d6ca_
  • Heterogens: CA, THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d6cA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrllevdtpetkhpkkgvekygpeasa
    ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnnt
    heqllrkaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d6cA (A:)
    lhkepatlikaidgdtvklmykgqpmtfrllevdtpetkhpkkgvekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniws