PDB entry 3d6b

View 3d6b on RCSB PDB site
Description: 2.2 A crystal structure of glutaryl-CoA dehydrogenase from Burkholderia pseudomallei
Class: oxidoreductase
Keywords: BURKHOLDERIA, PSEUDOMALLEI, GLUTARYL-COA, DEHYDROGENASE, SEATTLE STRUCTURAL GENOMICS CENTER FOR INFECTIOUS DISEASE, SSGCID, FAD, Flavoprotein, Oxidoreductase
Deposited on 2008-05-19, released 2008-06-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-09-21, with a file datestamp of 2011-09-16.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.212
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_3237
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3d6ba1, d3d6ba2
  • Chain 'B':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_3237
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3d6bb1, d3d6bb2
  • Chain 'C':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_3237
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3d6bc1, d3d6bc2
  • Chain 'D':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_3237
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3d6bd1, d3d6bd2
  • Heterogens: 54D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d6bA (A:)
    maaatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremge
    igllgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqk
    ekylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvfv
    vwakldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphv
    kglrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmq
    teitlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefgv
    arhlvnlevvntyegthdihalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d6bA (A:)
    atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
    lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
    lpklatgewigcfgltepmvtrarkvpggyslsgskmwitnspiadvfvvwakldedeir
    gfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkglrgpftclnsar
    ygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqteitlglqgvlrlg
    rmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefgvarhlvnlevvntyi
    halilgraqtgiqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d6bB (B:)
    maaatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremge
    igllgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqk
    ekylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvfv
    vwakldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphv
    kglrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmq
    teitlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefgv
    arhlvnlevvntyegthdihalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d6bB (B:)
    atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
    lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
    lpklatgewigcfgltepmvtrarkvpggyslsgskmwitnspiadvfvvwakldedeir
    gfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkglrgpftclnsar
    ygiawgalgaaescwhiarqyvldrlaanqliqkkladmqteitlglqgvlrlgrmkdeg
    taaveitsimkrnscgkaldiarlardmlggvarhlvnlevvntyegthdihalilgraq
    tgiqa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3d6bC (C:)
    maaatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremge
    igllgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqk
    ekylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvfv
    vwakldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphv
    kglrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmq
    teitlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefgv
    arhlvnlevvntyegthdihalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d6bC (C:)
    atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
    lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
    lpklatgewigcfgltepnhggsmvtrarkvpggyslsgskmwitnspiadvfvvwakld
    edgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkglrgp
    ftclnsarygiawgalgaaescwhiarqyvldrkqplaanqliqkkladmqteitlglqg
    vlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlgfgvarhlvnlevvntyegt
    hdihalilgraqtgiqa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3d6bD (D:)
    maaatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremge
    igllgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqk
    ekylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvfv
    vwakldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphv
    kglrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmq
    teitlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefgv
    arhlvnlevvntyegthdihalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d6bD (D:)
    aatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeig
    llgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkek
    ylpklatgewigcfgltepsmvtrarkvpggyslsgskmwitnspiadvfvvwaklddei
    rgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkglrgpftclnsa
    rygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqteitlglqgvlrl
    grmkdegtaaveitsimkrnscgkaldiarlardmlggngvarhlvnlevvntyehdiha
    lilgraqtgiqa