PDB entry 3d65
View 3d65 on RCSB PDB site
Description: Crystal structure of Textilinin-1, a Kunitz-type serine protease inhibitor from the Australian Common Brown snake venom, in complex with trypsin
Class: hydrolase inhibitor/hydrolase
Keywords: Serine protease inhibitor, trypsin, blood, coagulation, Calcium, Digestion, Hydrolase, Metal-binding, Protease, Secreted, Serine protease, Zymogen, HYDROLASE INHIBITOR/HYDROLASE COMPLEX
Deposited on
2008-05-19, released
2009-06-16
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-06-16, with a file datestamp of
2009-06-12.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.214
AEROSPACI score: 0.53
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'E':
Compound: cationic trypsin
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3d65e_ - Chain 'I':
Compound: Textilinin
Species: Pseudonaja textilis textilis [TaxId:169397]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3d65i_ - Heterogens: CA, HOH
PDB Chain Sequences:
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>3d65E (E:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
- Chain 'I':
Sequence, based on SEQRES records: (download)
>3d65I (I:)
rpdfcelpadtgpcrvrfpsfyynpdekkclefiyggcegnannfitkeecestcaa
Sequence, based on observed residues (ATOM records): (download)
>3d65I (I:)
rpdfcelpadtgpcrvrfpsfyynpdekkclefiyggcegnannfitkeecestca