PDB entry 3d62

View 3d62 on RCSB PDB site
Description: Development of Broad-Spectrum Halomethyl Ketone Inhibitors Against Coronavirus Main Protease 3CLpro
Class: hydrolase
Keywords: main protease 3CLpro, SARS, inhibitor, 95990, ATP-binding, Endonuclease, Exonuclease, Helicase, Hydrolase, Membrane, Metal-binding, Nuclease, Nucleotide-binding, Nucleotidyltransferase, RNA replication, RNA-binding, RNA-directed RNA polymerase, Thiol protease, Transferase, Transmembrane, Zinc-finger
Deposited on 2008-05-18, released 2008-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3C-like proteinase
    Species: SARS coronavirus [TaxId:227859]
    Gene: rep
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3d62a_
  • Heterogens: 959, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d62A (A:)
    frkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllirks
    nhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyngsp
    sgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegkfy
    gpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynyepl
    tqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqcs