PDB entry 3d61

View 3d61 on RCSB PDB site
Description: Crystal Structure Analysis of 1,5-alpha-arabinanase catalytic mutant (AbnBD147A) complexed to arabinobiose
Class: hydrolase
Keywords: Arabinanase, Glycosyl Hydrolase, beta-propeller, Geobacillus stearothermophilus, HYDROLASE
Deposited on 2008-05-18, released 2009-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Intracellular arabinanase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: abn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3EYM8 (0-313)
      • engineered (145)
    Domains in SCOPe 2.07: d3d61a_
  • Heterogens: FUB, AHR, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d61A (A:)
    vhfhpfgnvnfyemdwslkgdlwahdpviakegsrwyvfhtgsgiqiktsedgvhwenmg
    wvfpslpdwykqyvpekdedhlwapdicfyngiyylyysvstfgkntsviglatnqtldp
    rdpdyewkdmgpvihstasdnynaiapnvvfdqegqpwlsfgsfwsgiqliqldtetmkp
    aaqaelltiasrgeepnaieapfivcrngyyylfvsfdfccrgiestykiavgrskditg
    pyvdkngvsmmqgggtildegndrwigpghcavyfsgvsailvnhaydalkngeptlqir
    plywddegwpylsv