PDB entry 3d5z

View 3d5z on RCSB PDB site
Description: Crystal Structure Analysis of 1,5-alpha-arabinanase catalytic mutant (AbnBE201A) complexed to arabinotriose
Class: hydrolase
Keywords: Arabinanase, Glycosyl Hydrolase, beta-propeller, Geobacillus stearothermophilus
Deposited on 2008-05-18, released 2009-04-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Intracellular arabinanase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: abn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3EYM8 (0-313)
      • see remark 999 (7)
      • engineered (199)
    Domains in SCOPe 2.03: d3d5za_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d5zA (A:)
    vhfhpfggvnfyemdwslkgdlwahdpviakegsrwyvfhtgsgiqiktsedgvhwenmg
    wvfpslpdwykqyvpekdedhlwapdicfyngiyylyysvstfgkntsviglatnqtldp
    rdpdyewkdmgpvihstasdnynaidpnvvfdqegqpwlsfgsfwsgiqliqldtetmkp
    aaqaelltiasrgeepnaiaapfivcrngyyylfvsfdfccrgiestykiavgrskditg
    pyvdkngvsmmqgggtildegndrwigpghcavyfsgvsailvnhaydalkngeptlqir
    plywddegwpylsv