PDB entry 3d5i

View 3d5i on RCSB PDB site
Description: Crystal structure of ribonuclease Sa2 with exo-2',3'-cyclophosphorotioate
Class: Hydrolase
Keywords: ribonuclease, mononucleotide, protein-mononucleotide complex, exo-2',3'-cyclophosphorotioate, Hydrolase
Deposited on 2008-05-16, released 2009-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.21
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease
    Species: Streptomyces aureofaciens [TaxId:1894]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d5ia_
  • Chain 'B':
    Compound: Ribonuclease
    Species: Streptomyces aureofaciens [TaxId:1894]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d5ib_
  • Chain 'C':
    Compound: Ribonuclease
    Species: Streptomyces aureofaciens [TaxId:1894]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d5ic_
  • Heterogens: SO4, SGP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d5iA (A:)
    adpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvv
    tpgsndrgtrrvvtggygeqywspdhyatfqeidprc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d5iA (A:)
    aladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvtpg
    drgtrrvvtggygeqywspdhyatfqeidprc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d5iB (B:)
    adpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvv
    tpgsndrgtrrvvtggygeqywspdhyatfqeidprc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3d5iC (C:)
    adpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvv
    tpgsndrgtrrvvtggygeqywspdhyatfqeidprc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d5iC (C:)
    ladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvtpdr
    gtrrvvtggygeqywspdhyatfqeidprc