PDB entry 3d5g

View 3d5g on RCSB PDB site
Description: Structure of ribonuclease Sa2 complexes with mononucleotides: new aspects of catalytic reaction and substrate recognition
Class: Hydrolase
Keywords: ribonuclease, Hydrolase
Deposited on 2008-05-16, released 2009-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease
    Species: Streptomyces aureofaciens [TaxId:1894]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d5ga_
  • Chain 'B':
    Compound: Ribonuclease
    Species: Streptomyces aureofaciens [TaxId:1894]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d5gb_
  • Chain 'C':
    Compound: Ribonuclease
    Species: Streptomyces aureofaciens [TaxId:1894]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d5gc_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d5gA (A:)
    adpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvv
    tpgsndrgtrrvvtggygeqywspdhyatfqeidprc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d5gA (A:)
    dpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvt
    pgsndrgtrrvvtggygeqywspdhyatfqeidprc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d5gB (B:)
    adpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvv
    tpgsndrgtrrvvtggygeqywspdhyatfqeidprc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3d5gC (C:)
    adpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvv
    tpgsndrgtrrvvtggygeqywspdhyatfqeidprc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d5gC (C:)
    dpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvt
    pgsndrgtrrvvtggygeqywspdhyatfqeidprc