PDB entry 3d54

View 3d54 on RCSB PDB site
Description: Stucture of PurLQS from Thermotoga maritima
Class: ligase
Keywords: alpha-beta structure, ATP-binding, Cytoplasm, Ligase, Nucleotide-binding, Purine biosynthesis, Glutamine amidotransferase, LIGASE/UNKNOWN FUNCTION COMPLEX
Deposited on 2008-05-15, released 2008-07-22
The last revision prior to the SCOP 1.75 freeze date was dated 2008-08-12, with a file datestamp of 2008-08-08.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.252
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoribosylformylglycinamidine synthase II
    Species: Thermotoga maritima [TaxId:2336]
    Gene: purL
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3d54a1, d3d54a2, d3d54a3, d3d54a4
  • Chain 'B':
    Compound: Formylglycinamide ribonucleotide amidotransferase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Formylglycinamide ribonucleotide amidotransferase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Phosphoribosylformylglycinamidine synthase 1
    Species: Thermotoga maritima [TaxId:2336]
    Gene: purQ
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Phosphoribosylformylglycinamidine synthase II
    Species: Thermotoga maritima [TaxId:2336]
    Gene: purL
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3d54e1, d3d54e2, d3d54e3, d3d54e4
  • Chain 'F':
    Compound: Formylglycinamide ribonucleotide amidotransferase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Formylglycinamide ribonucleotide amidotransferase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Phosphoribosylformylglycinamidine synthase 1
    Species: Thermotoga maritima [TaxId:2336]
    Gene: purQ
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Phosphoribosylformylglycinamidine synthase II
    Species: Thermotoga maritima [TaxId:2336]
    Gene: purL
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3d54i1, d3d54i2, d3d54i3, d3d54i4
  • Chain 'J':
    Compound: Formylglycinamide ribonucleotide amidotransferase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Formylglycinamide ribonucleotide amidotransferase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Phosphoribosylformylglycinamidine synthase 1
    Species: Thermotoga maritima [TaxId:2336]
    Gene: purQ
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NA, ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d54A (A:)
    mgshhhhhhditslykkagsenlyfqmklrylnilkeklgreptfvelqafsvmwsehcg
    yshtkkyirrlpktgfegnagvvnlddyysvafkieshnhpsaiepyngaatgvggiird
    vlamgarptaifdslhmsriidgiiegiadygnsigvptvggelrisslyahnplvnvla
    agvvrndmlvdskasrpgqvivifggatgrdgihgasfasedltgdkatklsiqvgdpfa
    ekmlieaflemveeglvegaqdlgaggvlsatselvakgnlgaivhldrvplrepdmepw
    eilisesqermavvtspqkasrileiarkhllfgdvvaevieepvyrvmyrndlvmevpv
    qllanapeediveytpgkipefkrvefeevnarevfeqydhmvgtdtvvppgfgaavmri
    krdggyslvthsradlalqdtywgtliavlesvrktlsvgaeplaitncvnygdpdvdpv
    glsammtalknacefsgvpvasgnaslyntyqgkpipptlvvgmlgkvnpqkvakpkpsk
    vfavgwndfelerekelwrairklseegafilsssqlltrthvetfreyglkievklpev
    rpahqmvlvfsertpvvdvpvkeigtlsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d54A (A:)
    klrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgnagvvnlddyys
    vafkieshnhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiiegiad
    ygnsigvptvggelrisslyahnplvnvlaagvvrndmlvdskasrpgqvivifggatgr
    dgtklsiqvgdpfaekmlieaflemveeglvegaqdlgaggvlsatselvakgnlgaivh
    ldrvplrepdmepweilisesqermavvtspqkasrileiarkhllfgdvvaevieepvy
    rvmyrndlvmevpvqllanapeediveytpgkipefkrvefeevnarevfeqydhmvgtd
    tvvppgfgaavmrikrdggyslvthsradlalqdtywgtliavlesvrktlsvgaeplai
    tncvnygdpdvdpvglsammtalknacefsgvpvasgnaslyntyqgkpipptlvvgmlg
    kvnpqkvakpkpskvfavgwndfelerekelwrairklseegafilsssqlltrthvetf
    reyglkievklpevrpahqmvlvfsertpvvdvpvkeigtlsr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3d54E (E:)
    mgshhhhhhditslykkagsenlyfqmklrylnilkeklgreptfvelqafsvmwsehcg
    yshtkkyirrlpktgfegnagvvnlddyysvafkieshnhpsaiepyngaatgvggiird
    vlamgarptaifdslhmsriidgiiegiadygnsigvptvggelrisslyahnplvnvla
    agvvrndmlvdskasrpgqvivifggatgrdgihgasfasedltgdkatklsiqvgdpfa
    ekmlieaflemveeglvegaqdlgaggvlsatselvakgnlgaivhldrvplrepdmepw
    eilisesqermavvtspqkasrileiarkhllfgdvvaevieepvyrvmyrndlvmevpv
    qllanapeediveytpgkipefkrvefeevnarevfeqydhmvgtdtvvppgfgaavmri
    krdggyslvthsradlalqdtywgtliavlesvrktlsvgaeplaitncvnygdpdvdpv
    glsammtalknacefsgvpvasgnaslyntyqgkpipptlvvgmlgkvnpqkvakpkpsk
    vfavgwndfelerekelwrairklseegafilsssqlltrthvetfreyglkievklpev
    rpahqmvlvfsertpvvdvpvkeigtlsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d54E (E:)
    klrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgnagvvnlddyys
    vafkieshnhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiiegiad
    ygnsigvptvggelrisslyahnplvnvlaagvvrndmlvdskasrpgqvivifggatgr
    dgtklsiqvgdpfaekmlieaflemveeglvegaqdlgaggvlsatselvakgnlgaivh
    ldrvplrepdmepweilisesqermavvtspqkasrileiarkhllfgdvvaevieepvy
    rvmyrndlvmevpvqllanapeediveytpgkipefkrvefeevnarevfeqydhmvgtd
    tvvppgfgaavmrikrdggyslvthsradlalqdtywgtliavlesvrktlsvgaeplai
    tncvnygdpdvdpvglsammtalknacefsgvpvasgnaslyntyqgkpipptlvvgmlg
    kvnpqkvakpkpskvfavgwndfelerekelwrairklseegafilsssqlltrthvetf
    reyglkievklpevrpahqmvlvfsertpvvdvpvkeigtlsr
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3d54I (I:)
    mgshhhhhhditslykkagsenlyfqmklrylnilkeklgreptfvelqafsvmwsehcg
    yshtkkyirrlpktgfegnagvvnlddyysvafkieshnhpsaiepyngaatgvggiird
    vlamgarptaifdslhmsriidgiiegiadygnsigvptvggelrisslyahnplvnvla
    agvvrndmlvdskasrpgqvivifggatgrdgihgasfasedltgdkatklsiqvgdpfa
    ekmlieaflemveeglvegaqdlgaggvlsatselvakgnlgaivhldrvplrepdmepw
    eilisesqermavvtspqkasrileiarkhllfgdvvaevieepvyrvmyrndlvmevpv
    qllanapeediveytpgkipefkrvefeevnarevfeqydhmvgtdtvvppgfgaavmri
    krdggyslvthsradlalqdtywgtliavlesvrktlsvgaeplaitncvnygdpdvdpv
    glsammtalknacefsgvpvasgnaslyntyqgkpipptlvvgmlgkvnpqkvakpkpsk
    vfavgwndfelerekelwrairklseegafilsssqlltrthvetfreyglkievklpev
    rpahqmvlvfsertpvvdvpvkeigtlsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d54I (I:)
    klrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgnagvvnlddyys
    vafkieshnhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiiegiad
    ygnsigvptvggelrisslyahnplvnvlaagvvrndmlvdskasrpgqvivifggatgr
    dgtklsiqvgdpfaekmlieaflemveeglvegaqdlgaggvlsatselvakgnlgaivh
    ldrvplrepdmepweilisesqermavvtspqkasrileiarkhllfgdvvaevieepvy
    rvmyrndlvmevpvqllanapeediveytpgkipefkrvefeevnarevfeqydhmvgtd
    tvvppgfgaavmrikrdggyslvthsradlalqdtywgtliavlesvrktlsvgaeplai
    tncvnygdpdvdpvglsammtalknacefsgvpvasgnaslyntyqgkpipptlvvgmlg
    kvnpqkvakpkpskvfavgwndfelerekelwrairklseegafilsssqlltrthvetf
    reyglkievklpevrpahqmvlvfsertpvvdvpvkeigtlsr
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.