PDB entry 3d4w

View 3d4w on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS A109R at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, hydrolase, internal arg, Endonuclease, Metal-binding, Secreted, Zymogen
Deposited on 2008-05-15, released 2009-01-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NXI6
      • engineered (43-44)
      • engineered (102)
      • engineered (110)
      • engineered (121)
    Domains in SCOPe 2.06: d3d4wa_
  • Heterogens: PO4, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d4wA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglrkvayvykgnntheqllr
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d4wA (A:)
    klhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakk
    ievefdkgqrtdkygrglayiyadgkmvnealvrqglrkvayvykgnntheqllrkaeaq
    akkeklniwsed