PDB entry 3d4v

View 3d4v on RCSB PDB site
Description: Crystal Structure of an AlkA Host/Guest Complex N7MethylGuanine:Cytosine Base Pair
Class: hydrolase/DNA
Keywords: AlkA, N7MethylGuanine, DNA repair, host-guest complex, DNA structure, DNA damage, Hydrolase, HYDROLASE-DNA COMPLEX
Deposited on 2008-05-15, released 2008-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-3-methyladenine glycosylase 2
    Species: Escherichia coli [TaxId:562]
    Gene: alkA, aidA, b2068, JW2053
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d4va1, d3d4va2
  • Chain 'B':
    Compound: DNA-3-methyladenine glycosylase 2
    Species: Escherichia coli [TaxId:562]
    Gene: alkA, aidA, b2068, JW2053
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d4vb1, d3d4vb2
  • Chain 'C':
    Compound: DNA-3-methyladenine glycosylase 2
    Species: Escherichia coli [TaxId:562]
    Gene: alkA, aidA, b2068, JW2053
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d4vc1, d3d4vc2
  • Chain 'D':
    Compound: DNA-3-methyladenine glycosylase 2
    Species: Escherichia coli [TaxId:562]
    Gene: alkA, aidA, b2068, JW2053
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d4vd1, d3d4vd2
  • Chain 'E':
    Compound: 5'-d(*dgp*dap*dcp*dap*dtp*dgp*dap*(fmg)p*dtp*dgp*dcp*dc)-3'
  • Chain 'F':
    Compound: 5'-d(*dgp*dgp*dcp*dap*dcp*dtp*dcp*dap*dtp*dgp*dtp*dc)-3'
  • Chain 'G':
    Compound: 5'-d(*dgp*dap*dcp*dap*dtp*dgp*dap*(fmg)p*dtp*dgp*dcp*dc)-3'
  • Chain 'H':
    Compound: 5'-d(*dgp*dgp*dcp*dap*dcp*dtp*dcp*dap*dtp*dgp*dtp*dc)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d4vA (A:)
    mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
    inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlgaarpglrlpgcvdafeqgvra
    ilgqlvsvamaakltarvaqlygerlddfpeyicfptpqrlaaadpqalkalgmplkrae
    alihlanaalegtlpmtipgdveqamktlqtfpgigrwtanyfalrgwqakdvflpddyl
    ikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqpdea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d4vB (B:)
    mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
    inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlgaarpglrlpgcvdafeqgvra
    ilgqlvsvamaakltarvaqlygerlddfpeyicfptpqrlaaadpqalkalgmplkrae
    alihlanaalegtlpmtipgdveqamktlqtfpgigrwtanyfalrgwqakdvflpddyl
    ikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqpdea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3d4vC (C:)
    mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
    inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlgaarpglrlpgcvdafeqgvra
    ilgqlvsvamaakltarvaqlygerlddfpeyicfptpqrlaaadpqalkalgmplkrae
    alihlanaalegtlpmtipgdveqamktlqtfpgigrwtanyfalrgwqakdvflpddyl
    ikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqpdea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d4vC (C:)
    mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
    inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlgaarpglrlpgcvdafeqgvra
    ilgqlvsvamaakltarvaqlygerlddfpeyicfptpqrlaaadpqalkalgmplkrae
    alihlanaalegtlpmtipgdveqamktlqtfpgigrwtanyfalrgwqakdvflpddyl
    ikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqpde
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3d4vD (D:)
    mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
    inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlgaarpglrlpgcvdafeqgvra
    ilgqlvsvamaakltarvaqlygerlddfpeyicfptpqrlaaadpqalkalgmplkrae
    alihlanaalegtlpmtipgdveqamktlqtfpgigrwtanyfalrgwqakdvflpddyl
    ikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqpdea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d4vD (D:)
    mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
    inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlgaarpglrlpgcvdafeqgvra
    ilgqlvsvamaakltarvaqlygerlddfpeyicfptpqrlaaadpqalkalgmplkrae
    alihlanaalegtlpmtipgdveqamktlqtfpgigrwtanyfalrgwqakdvflpddyl
    ikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqpde
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.