PDB entry 3d4q

View 3d4q on RCSB PDB site
Description: Pyrazole-based inhibitors of B-Raf kinase
Class: transferase
Keywords: Kinase, ATP-binding, Cardiomyopathy, Disease mutation, Metal-binding, Nucleotide-binding, Phorbol-ester binding, Phosphoprotein, Proto-oncogene, Serine/threonine-protein kinase, Transferase, Zinc-finger
Deposited on 2008-05-14, released 2008-08-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-09-08, with a file datestamp of 2010-09-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.216
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-Raf proto-oncogene serine/threonine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, RAFB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3d4qa_
  • Chain 'B':
    Compound: B-Raf proto-oncogene serine/threonine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, RAFB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3d4qb_
  • Heterogens: SM5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d4qA (A:)
    mdrgshhhhhhgsedrnrmktlgrrdssddweipdgqitvgqrigsgsfgtvykgkwhgd
    vavkmlnvtaptpqqlqafknevgvlrktrhvnillfmgystkpqlaivtqwcegsslyh
    hlhiietkfemiklidiarqtaqgmdylhaksiihrdlksnniflhedltvkigdfglat
    vksrwsgshqfeqlsgsilwmapevirmqdknpysfqsdvyafgivlyelmtgqlpysni
    nnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkkkrderplfpqilasiellar
    slpkihr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d4qA (A:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglatvlsgsilwmapevirmqdknpysfqsdv
    yafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkk
    krderplfpqilasiellarslpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d4qB (B:)
    mdrgshhhhhhgsedrnrmktlgrrdssddweipdgqitvgqrigsgsfgtvykgkwhgd
    vavkmlnvtaptpqqlqafknevgvlrktrhvnillfmgystkpqlaivtqwcegsslyh
    hlhiietkfemiklidiarqtaqgmdylhaksiihrdlksnniflhedltvkigdfglat
    vksrwsgshqfeqlsgsilwmapevirmqdknpysfqsdvyafgivlyelmtgqlpysni
    nnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkkkrderplfpqilasiellar
    slpkihr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d4qB (B:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglatvlsgsilwmapevirmqdknpysfqsdv
    yafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkk
    krderplfpqilasiellarslpk