PDB entry 3d4p

View 3d4p on RCSB PDB site
Description: Crystal structure of Lactate Dehydrogenase from Staphylococcus Aureus complexed with NAD and pyruvate
Class: oxidoreductase
Keywords: Lactate Dehydrogenase, Staphylococcus Aureus, NAD, pyruvate, Cytoplasm, Glycolysis, Oxidoreductase, Phosphoprotein
Deposited on 2008-05-14, released 2009-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase 1
    Species: Staphylococcus aureus subsp. aureus COL [TaxId:93062]
    Gene: ldh1, SACOL0222
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d4pa1, d3d4pa2
  • Chain 'B':
    Compound: L-lactate dehydrogenase 1
    Species: Staphylococcus aureus subsp. aureus COL [TaxId:93062]
    Gene: ldh1, SACOL0222
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d4pb1, d3d4pb2
  • Heterogens: NAD, PYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d4pA (A:)
    mnkfkgnkvvligngavgssyafslvnqsivdelviidldtekvrgdvmdlkhatpyspt
    tvrvkageysdchdadlvvicagaaqkpgetrldlvsknlkifksivgevmaskfdgifl
    vatnpvdilayatwkfsglpkervigsgtildsarfrlllseafdvaprsvdaqiigehg
    dtelpvwshaniagqplktlleqrpegkaqieqifvqtrdaaydiiqakgatyygvamgl
    ariteaifrnedavltvsallegeyeeedvyigvpavinrngirnvveiplndeeqskfa
    hsaktlkdimaeaeelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d4pA (A:)
    fkgnkvvligngavgssyafslvnqsivdelviidldtekvrgdvmdlkhatpyspttvr
    vkageysdchdadlvvicagaaqkptrldlvsknlkifksivgevmaskfdgiflvatnp
    vdilayatwkfsglpkervigsgtildsarfrlllseafdvaprsvdaqiigehgdtelp
    vwshaniagqplktlleqrpegkaqieqifvqtrdaaydiiqakgatyygvamglarite
    aifrnedavltvsallegeyeeedvyigvpavinrngirnvveiplndeeqskfahsakt
    lkdimae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d4pB (B:)
    mnkfkgnkvvligngavgssyafslvnqsivdelviidldtekvrgdvmdlkhatpyspt
    tvrvkageysdchdadlvvicagaaqkpgetrldlvsknlkifksivgevmaskfdgifl
    vatnpvdilayatwkfsglpkervigsgtildsarfrlllseafdvaprsvdaqiigehg
    dtelpvwshaniagqplktlleqrpegkaqieqifvqtrdaaydiiqakgatyygvamgl
    ariteaifrnedavltvsallegeyeeedvyigvpavinrngirnvveiplndeeqskfa
    hsaktlkdimaeaeelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d4pB (B:)
    fkgnkvvligngavgssyafslvnqsivdelviidldtekvrgdvmdlkhatpyspttvr
    vkageysdchdadlvvicagaaqkpgetrldlvsknlkifksivgevmaskfdgiflvat
    npvdilayatwkfsglpkervigsgtildsarfrlllseafdvaprsvdaqiigehgdte
    lpvwshaniagqplktlleqrpegkaqieqifvqtrdaaydiiqakgatyygvamglari
    teaifrnedavltvsallegeyeeedvyigvpavinrngirnvveiplndeeqskfahsa
    ktlkdimaea