PDB entry 3d4n

View 3d4n on RCSB PDB site
Description: Crystal Structure of Human 11-beta-Hydroxysteroid Dehydrogenase (HSD1) in Complex with Sulfonamide Inhibitor
Class: oxidoreductase
Keywords: oxidoreductase, 11beta, hydroxysteroid, dehydrogenase, Endoplasmic reticulum, Glycoprotein, Lipid metabolism, Membrane, Microsome, NADP, Polymorphism, Signal-anchor, Steroid metabolism, Transmembrane
Deposited on 2008-05-14, released 2008-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.228
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: HOMO SAPIENS
    Gene: HSD11B1, HSD11, HSD11L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28845 (17-End)
      • expression tag (14-16)
      • engineered (265)
    Domains in SCOPe 2.07: d3d4na2, d3d4na3
  • Chain 'B':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: HOMO SAPIENS
    Gene: HSD11B1, HSD11, HSD11L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28845 (17-End)
      • expression tag (13-16)
      • engineered (265)
    Domains in SCOPe 2.07: d3d4nb2, d3d4nb3
  • Chain 'C':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: HOMO SAPIENS
    Gene: HSD11B1, HSD11, HSD11L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28845 (17-End)
      • expression tag (13-16)
      • engineered (265)
    Domains in SCOPe 2.07: d3d4nc2, d3d4nc3
  • Chain 'D':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: HOMO SAPIENS
    Gene: HSD11B1, HSD11, HSD11L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28845 (17-End)
      • expression tag (13-16)
      • engineered (265)
    Domains in SCOPe 2.07: d3d4nd2, d3d4nd3
  • Heterogens: NAP, D4N, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d4nA (A:)
    mkhqhqhqhqhqhqqplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtar
    sketlqkvvshclelgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntsl
    nlfhddihhvrksmevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysas
    kfaldgffssirkeysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleii
    kggalrqeevyydsslwttllirnpsrkileflystsynmdrfink
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d4nA (A:)
    qplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshcle
    lgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksm
    evnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirke
    ysvsrvnvsitlcvlglidtetamkavsivhmqaapkeecaleiikggalrqeevyydss
    lwttllirnpsrkileflyst
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d4nB (B:)
    mkhqhqhqhqhqhqqplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtar
    sketlqkvvshclelgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntsl
    nlfhddihhvrksmevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysas
    kfaldgffssirkeysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleii
    kggalrqeevyydsslwttllirnpsrkileflystsynmdrfink
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d4nB (B:)
    qqplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshcl
    elgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrks
    mevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirk
    eysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyyd
    sslwttllirnpsrkileflystsy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3d4nC (C:)
    mkhqhqhqhqhqhqqplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtar
    sketlqkvvshclelgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntsl
    nlfhddihhvrksmevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysas
    kfaldgffssirkeysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleii
    kggalrqeevyydsslwttllirnpsrkileflystsynmdrfink
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d4nC (C:)
    qqplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshcl
    elgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrks
    mevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirk
    eysvsrvnvsitlcvlglidtetamkavsgimqaapkeecaleiikggalrqeevyydss
    lwttllirnpsrkileflys
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3d4nD (D:)
    mkhqhqhqhqhqhqqplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtar
    sketlqkvvshclelgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntsl
    nlfhddihhvrksmevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysas
    kfaldgffssirkeysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleii
    kggalrqeevyydsslwttllirnpsrkileflystsynmdrfink
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d4nD (D:)
    qqplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshcl
    elgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrks
    mevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirk
    eysvsrvnvsitlcvlglidtetamkavsgihmqaapkeecaleiikggalrqeevyyds
    slwttllirnpsrkileflys