PDB entry 3d4m

View 3d4m on RCSB PDB site
Description: Glutaredoxin 2 oxidized structure
Class: oxidoreductase
Keywords: Grx2, Cytoplasm, Electron transport, Mitochondrion, Redox-active center, Transit peptide, Transport, OXIDOREDUCTASE
Deposited on 2008-05-14, released 2008-10-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Glutaredoxin-2, mitochondrial
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: GRX2, TTR, TTR1, YDR513W, D9719.17
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17695 (0-108)
  Domains in SCOPe 2.08: d3d4ma_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3d4mA (A:)
  mvsqetvahvkdligqkevfvaaktycpyckatlstlfqelnvpkskalvleldemsngs
  eiqdaleeisgqktvpnvyingkhiggnsdletlkkngklaeilkpvfq