PDB entry 3d4b

View 3d4b on RCSB PDB site
Description: Crystal structure of Sir2Tm in complex with Acetyl p53 peptide and DADMe-NAD+
Class: hydrolase
Keywords: Rossmann Fold, Cytoplasm, Hydrolase, Metal-binding, NAD, Zinc
Deposited on 2008-05-14, released 2008-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent deacetylase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: npdA, TM_0490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d4ba_
  • Chain 'D':
    Compound: Acetyl P53 peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 3D4B (0-8)
  • Heterogens: ZN, DZD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d4bA (A:)
    mkmkefldllnesrltvtltgagistpsgipdfrgpngiykkysqnvfdidffyshpeef
    yrfakegifpmlqakpnlahvllakleekglieavitqnidrlhqragskkvielhgnve
    eyycvrcekkytvedvikklessdvplcddcnslirpnivffgenlpqdalreaiglssr
    aslmivlgsslvvypaaelplitvrsggklvivnlgetpfddiatlkynmdvvefarrvm
    eeggis
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d4bA (A:)
    mkmkefldllnesrltvtltgagistpsgipdfnvfdidffyshpeefyrfakegifpml
    qakpnlahvllakleekglieavitqnidrlhqragskkvielhgnveeyycvrcekkyt
    vedvikklessdvplcddcnslirpnivffgenlpqdalreaiglssraslmivlgsslv
    vypaaelplitvrsggklvivnlgetpfddiatlkynmdvvefarrvmeeggi
    

  • Chain 'D':
    No sequence available.