PDB entry 3d4a

View 3d4a on RCSB PDB site
Description: Crystal structure of ribonuclease Sa2 with 3'-GMP obtained by ligand diffusion
Class: Hydrolase
Keywords: ribonuclease, mononucleotide, protein-mononucleotide complex, Hydrolase
Deposited on 2008-05-14, released 2009-05-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.223
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease
    Species: Streptomyces aureofaciens [TaxId:1894]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3d4aa_
  • Chain 'B':
    Compound: Ribonuclease
    Species: Streptomyces aureofaciens [TaxId:1894]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3d4ab_
  • Chain 'C':
    Compound: Ribonuclease
    Species: Streptomyces aureofaciens [TaxId:1894]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3d4ac_
  • Heterogens: SO4, 3GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d4aA (A:)
    adpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvv
    tpgsndrgtrrvvtggygeqywspdhyatfqeidprc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d4aA (A:)
    paladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvtp
    gsndrgtrrvvtggygeqywspdhyatfqeidprc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d4aB (B:)
    adpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvv
    tpgsndrgtrrvvtggygeqywspdhyatfqeidprc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d4aB (B:)
    adpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvv
    tpgdrgtrrvvtggygeqywspdhyatfqeidprc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3d4aC (C:)
    adpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvv
    tpgsndrgtrrvvtggygeqywspdhyatfqeidprc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d4aC (C:)
    ladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvtprg
    trrvvtggygeqywspdhyatfqeidprc