PDB entry 3d3x

View 3d3x on RCSB PDB site
Description: Crystal structure of botulinum neurotoxin serotype E catalytic domain in complex with SNAP-25 substrate peptide
Class: hydrolase/hydrolase substrate
Keywords: BoNT E, SNAP-25, Enzyme-substrate complex, HYDROLASE, HYDROLASE-HYDROLASE SUBSTRATE COMPLEX
Deposited on 2008-05-13, released 2008-07-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.235
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type E botulinum toxin
    Species: Clostridium butyricum [TaxId:1492]
    Gene: bont/E
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3d3xa_
  • Chain 'B':
    Compound: Type E botulinum toxin
    Species: Clostridium butyricum [TaxId:1492]
    Gene: bont/E
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3d3xb_
  • Chain 'C':
    Compound: SNAP-25 substrate peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 3D3X (0-End)
  • Chain 'D':
    Compound: SNAP-25 substrate peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 3D3X (0-3)
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d3xA (A:)
    pkinsfnyndpvndrtilyikpggcqefyksfnimkniwiipernvigttpqdfhpptsl
    kngdssyydpnylqsdeekdrflkivtkifnrinnnlsggilleelskanpylgndntpd
    nqfhigdasaveikfsngsqdillpnviimgaepdlfetnssnislrnnympsnhgfgsi
    aivtfspeysfrfndnsmnefiqdpaltlmhelihslhglygakgittkytitqkqnpli
    tnirgtnieefltfggtdlniitsaqsndiytnlladykkiasklskvqvsnpllnpykd
    vfeakygldkdasgiysvninkfndifkklysftefdlatkfqvkcrqtyigqykyfkls
    nllndsiynisegyninnlkvnfrgqnanlnpriitpitgrglvkkiirfcknivsvkgi
    rhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d3xA (A:)
    pkinsfnyndpvndrtilyikpggcqefyksfnimkniwiipernvigttpqdfhpptsl
    kngdssyydpnylqsdeekdrflkivtkifnrinnnlsggilleelskanpylgndntpd
    nqfhigdasaveikfsngsqdillpnviimgaepdlfetnssnislrnnympsnhgfgsi
    aivtfspeysfrfndnsmnefiqdpaltlmhelihslhglygakgittkytitqlitnir
    gtnieefltfggtdlniitsaqsndiytnlladykkiasklskvqvsnpllnpykdvfea
    kygldkdasgiysvninkfndifkklysftefdlatkfqvkcrqtyigqykyfklsnlln
    dsiynisegyninnlkvnfrgqnanlnpriitpitgrglvkkiirfc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d3xB (B:)
    pkinsfnyndpvndrtilyikpggcqefyksfnimkniwiipernvigttpqdfhpptsl
    kngdssyydpnylqsdeekdrflkivtkifnrinnnlsggilleelskanpylgndntpd
    nqfhigdasaveikfsngsqdillpnviimgaepdlfetnssnislrnnympsnhgfgsi
    aivtfspeysfrfndnsmnefiqdpaltlmhelihslhglygakgittkytitqkqnpli
    tnirgtnieefltfggtdlniitsaqsndiytnlladykkiasklskvqvsnpllnpykd
    vfeakygldkdasgiysvninkfndifkklysftefdlatkfqvkcrqtyigqykyfkls
    nllndsiynisegyninnlkvnfrgqnanlnpriitpitgrglvkkiirfcknivsvkgi
    rhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d3xB (B:)
    pkinsfnyndpvndrtilyikpggcqefyksfnimkniwiipernvigttpqdfhpptkn
    gdssyydpnylqsdeekdrflkivtkifnrinnnlsggilleelskanpylgndntpdnq
    fhigdasaveikfsngsqdillpnviimgaepdlfetnssnislrnnympsnhgfgsiai
    vtfspeysfrfndnsmnefiqdpaltlmhelihslhglygakgittkytitqkqnplitn
    irgtnieefltfggtdlniitsaqsndiytnlladykkiasklskvqvsnpllnpykdvf
    eakygldkdasgiysvninkfndifkklysftefdlatkfqvkcrqtyigqykyfklsnl
    lndsiynisegyninnlkvnfrgqnanlnpriitpitgrglvkkiir
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.