PDB entry 3d3w

View 3d3w on RCSB PDB site
Description: Structure of L-Xylulose Reductase with bound coenzyme, phosphate and hydroxide.
Class: oxidoreductase
Keywords: L-Xylulose Reductase, Uronate Cycle, Short-Chain Dehydrogenase/Reductase(SDR) Superfamily, Glucose Metabolism, Acetylation, Carbohydrate metabolism, Membrane, NADP, Oxidoreductase, Xylose metabolism
Deposited on 2008-05-12, released 2009-04-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-07-28, with a file datestamp of 2009-07-24.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.207
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-xylulose reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: DCXR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3d3wa_
  • Chain 'B':
    Compound: L-xylulose reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: DCXR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7Z4W1 (0-243)
      • microheterogeneity (137)
    Domains in SCOPe 2.04: d3d3wb_
  • Heterogens: NAP, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d3wA (A:)
    melflagrrvlvtgagkgigrgtvqalhatgarvvavsrtqadldslvrecpgiepvcvd
    lgdweateralgsvgpvdllvnnaavallqpflevtkeafdrsfevnlraviqvsqivar
    gliargvpgaivnvssqcsqravtnhsvycstkgaldmltkvmalelgphkirvnavnpt
    vvmtsmgqatwsdphkaktmlnriplgkfaevehvvnailfllsdrsgmttgstlpvegg
    fwac
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d3wB (B:)
    melflagrrvlvtgagkgigrgtvqalhatgarvvavsrtqadldslvrecpgiepvcvd
    lgdweateralgsvgpvdllvnnaavallqpflevtkeafdrsfevnlraviqvsqivar
    gliargvpgaivnvssqcsqravtnhsvycstkgaldmltkvmalelgphkirvnavnpt
    vvmtsmgqatwsdphkaktmlnriplgkfaevehvvnailfllsdrsgmttgstlpvegg
    fwac