PDB entry 3d3t

View 3d3t on RCSB PDB site
Description: Crystal Structure of HIV-1 CRF01_AE in complex with the substrate p1-p6
Class: hydrolase
Keywords: HIV-1 protease, non-B clades, CRF01_AE, p1-p6 substrate, AIDS, Aspartyl protease, HYDROLASE
Deposited on 2008-05-12, released 2008-07-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90VT5 (0-98)
      • engineered (24)
    Domains in SCOPe 2.08: d3d3ta_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90VT5 (0-98)
      • engineered (24)
    Domains in SCOPe 2.08: d3d3tb_
  • Chain 'P':
    Compound: p1-p6 substrate peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d3tA (A:)
    pqitlwqrplvtikiggqlreallntgaddtvledinlpgkwkpkmiggiggfikvrqyd
    qilieicgkkaigtvlvgptpvniigrnmltqlgctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d3tB (B:)
    pqitlwqrplvtikiggqlreallntgaddtvledinlpgkwkpkmiggiggfikvrqyd
    qilieicgkkaigtvlvgptpvniigrnmltqlgctlnf
    

  • Chain 'P':
    No sequence available.