PDB entry 3d3t
View 3d3t on RCSB PDB site
Description: Crystal Structure of HIV-1 CRF01_AE in complex with the substrate p1-p6
Class: hydrolase
Keywords: HIV-1 protease, non-B clades, CRF01_AE, p1-p6 substrate, AIDS, Aspartyl protease, HYDROLASE
Deposited on
2008-05-12, released
2008-07-08
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-10-25, with a file datestamp of
2017-10-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3d3ta_ - Chain 'B':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3d3tb_ - Chain 'P':
Compound: p1-p6 substrate peptide
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3d3tA (A:)
pqitlwqrplvtikiggqlreallntgaddtvledinlpgkwkpkmiggiggfikvrqyd
qilieicgkkaigtvlvgptpvniigrnmltqlgctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3d3tB (B:)
pqitlwqrplvtikiggqlreallntgaddtvledinlpgkwkpkmiggiggfikvrqyd
qilieicgkkaigtvlvgptpvniigrnmltqlgctlnf
- Chain 'P':
No sequence available.