PDB entry 3d3r

View 3d3r on RCSB PDB site
Description: Crystal structure of the hydrogenase assembly chaperone HypC/HupF family protein from Shewanella oneidensis MR-1
Class: chaperone
Keywords: small beta-barrel, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, CHAPERONE
Deposited on 2008-05-12, released 2008-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.203
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydrogenase assembly chaperone hypC/hupF
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: hypC, SO_2092
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EF93 (21-End)
      • expression tag (14-20)
    Domains in SCOPe 2.07: d3d3ra1, d3d3ra2
  • Chain 'B':
    Compound: Hydrogenase assembly chaperone hypC/hupF
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: hypC, SO_2092
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EF93 (21-End)
      • expression tag (17-20)
    Domains in SCOPe 2.07: d3d3rb2, d3d3rb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d3rA (A:)
    mgsshhhhhhssgrenlyfqgmclsipsqvvavdnerqsvtvdtlgvrrdvsshlmtepl
    aigdyvlihigfvmnkidrndalqslelyqeivsklenettgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d3rA (A:)
    enlyfqgmclsipsqvvavdnerqsvtvdtlgvrrdvsshlmteplaigdyvlihigfvm
    nkidrndalqslelyqeivskle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d3rB (B:)
    mgsshhhhhhssgrenlyfqgmclsipsqvvavdnerqsvtvdtlgvrrdvsshlmtepl
    aigdyvlihigfvmnkidrndalqslelyqeivsklenettgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d3rB (B:)
    yfqgmclsipsqvvavdnerqsvtvdtlgvrrdvsshlmteplaigdyvlihigfvmnki
    drndalqslelyqeivskle