PDB entry 3d3h

View 3d3h on RCSB PDB site
Description: Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A
Class: transferase/antibiotic
Keywords: peptidoglycan glycosyltransferase, cell wall biosynthesis, antibiotics, penicillin-binding protein, transglycosylase, moenomycin, Antibiotic resistance, Cell shape, Cell wall biogenesis/degradation, Hydrolase, Inner membrane, Membrane, Multifunctional enzyme, Peptidoglycan synthesis, Signal-anchor, Transmembrane, TRANSFERASE-ANTIBIOTIC COMPLEX
Deposited on 2008-05-11, released 2008-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.225
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Penicillin-insensitive transglycosylase
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: mrcA, ponA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3d3ha_
  • Heterogens: M4O, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d3hA (A:)
    gpgyqdpkgrlygtigiqkrfyvsidkipehvinafvatedrnfwhhfgidpvaivraai
    vnyragrivqggstitqqlaknlfltrertlerkikeallaikiertfdkkkimelylnq
    iylgsgaygveaaaqvyfgkhvwelsldeaallaalpkapakynpfyhperalqrrnlvl
    krmleegyitpeqyeeavnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d3hA (A:)
    qkrfyvsidkipehvinafvatedrnfwhhfgidpvaivraaiqggstitqqlaknlflt
    rertlerkikeallaikiertfdkkkimelylnqiylgsgaygveaaaqvyfgkhvwels
    ldeaallaalpkapakynpfyhperalqrrnlvlkrmleegyitpeqyeeavnk