PDB entry 3d3e

View 3d3e on RCSB PDB site
Description: Crystal Structure of Human 11-beta-Hydroxysteroid Dehydrogenase (HSD1) in Complex with Benzamide Inhibitor
Class: oxidoreductase
Keywords: oxidoreductase, 11beta, hydroxysteroid, dehydrogenase, Endoplasmic reticulum, Glycoprotein, Lipid metabolism, Membrane, Microsome, NADP, Polymorphism, Signal-anchor, Steroid metabolism, Transmembrane
Deposited on 2008-05-09, released 2008-07-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.23
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: HOMO SAPIENS
    Gene: HSD11B1, HSD11, HSD11L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28845 (17-End)
      • expression tag (14-16)
      • engineered (265)
    Domains in SCOPe 2.01: d3d3ea_
  • Chain 'B':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: HOMO SAPIENS
    Gene: HSD11B1, HSD11, HSD11L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28845 (17-End)
      • expression tag (14-16)
      • engineered (265)
    Domains in SCOPe 2.01: d3d3eb_
  • Chain 'C':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: HOMO SAPIENS
    Gene: HSD11B1, HSD11, HSD11L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28845 (17-End)
      • expression tag (14-16)
      • engineered (265)
    Domains in SCOPe 2.01: d3d3ec_
  • Chain 'D':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: HOMO SAPIENS
    Gene: HSD11B1, HSD11, HSD11L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28845 (17-End)
      • expression tag (14-16)
      • engineered (265)
    Domains in SCOPe 2.01: d3d3ed_
  • Heterogens: NAP, D3E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d3eA (A:)
    mkhqhqhqhqhqhqqplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtar
    sketlqkvvshclelgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntsl
    nlfhddihhvrksmevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysas
    kfaldgffssirkeysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleii
    kggalrqeevyydsslwttllirnpsrkileflystsynmdrfink
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d3eA (A:)
    qplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshcle
    lgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksm
    evnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirke
    ysvsrvnvsitlcvlglidtetamkavsgivqaapkeecaleiikggalrqeevyydssl
    wttllirnpsrkileflystsy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d3eB (B:)
    mkhqhqhqhqhqhqqplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtar
    sketlqkvvshclelgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntsl
    nlfhddihhvrksmevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysas
    kfaldgffssirkeysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleii
    kggalrqeevyydsslwttllirnpsrkileflystsynmdrfink
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d3eB (B:)
    qplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshcle
    lgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksm
    evnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirke
    ysvsrvnvsitlcvlglidtetamkavsgivqaapkeecaleiikggalrqeevyydssl
    wttllirnpsrkileflys
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3d3eC (C:)
    mkhqhqhqhqhqhqqplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtar
    sketlqkvvshclelgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntsl
    nlfhddihhvrksmevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysas
    kfaldgffssirkeysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleii
    kggalrqeevyydsslwttllirnpsrkileflystsynmdrfink
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d3eC (C:)
    qplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshcle
    lgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksm
    evnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirke
    ysvsrvnvsitlcvlglidtetamkavsgivqaapkeecaleiikggalrqeevyydssl
    wttllirnpsrkileflys
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3d3eD (D:)
    mkhqhqhqhqhqhqqplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtar
    sketlqkvvshclelgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntsl
    nlfhddihhvrksmevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysas
    kfaldgffssirkeysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleii
    kggalrqeevyydsslwttllirnpsrkileflystsynmdrfink
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d3eD (D:)
    qplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshcle
    lgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksm
    evnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirke
    ysvsrvnvsitlcvlglidtetamkavsgivqaapkeecaleiikggalrqeevyydssl
    wttllirnpsrkileflys