PDB entry 3d37

View 3d37 on RCSB PDB site
Description: The crystal structure of the tail protein from Neisseria meningitidis MC58
Class: structural genomics, unknown function
Keywords: tail protein, structural genomics, PSI, MCSG, Protein Structure Initiative, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2008-05-09, released 2008-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.222
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tail protein, 43 kDa
    Species: Neisseria meningitidis MC58 [TaxId:122586]
    Gene: GI:7226348, NMB1110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d37a1, d3d37a2
  • Chain 'B':
    Compound: Tail protein, 43 kDa
    Species: Neisseria meningitidis MC58 [TaxId:122586]
    Gene: GI:7226348, NMB1110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d37b1, d3d37b2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d37A (A:)
    mqnnsygyavsvrvggkehrhwerydidsdflipadsfdfvigrlgpeaaipdlsgesce
    vvidgqivmtgiigsqrhgkskgsrelslsgrdlagflvdcsapqlnvkgmtvldaakkl
    aapwpqikavvlkaennpalgkidiepgetvwqalthiansvglhpwlepdgtlvvggad
    yssppvatlcwsrtdsrcniermdiewdtdnrfsevtflaqshgrsgdsakhdlkwvykd
    ptmtlhrpktvvvsdadnlaalqkqakkqladwrlegftltitvgghktrdgvlwqpglr
    vhviddehgidavfflmgrrfmlsrmdgtqtelrlkedgiwtpdaypkkaeaarkrkgkr
    kgvshkgkkggkkqaetavfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d37A (A:)
    ygyavsvrvggkehrhwerydidsdflipadsfdfvigrpdlsgescevvidgqivmtgi
    igsqrhgkskgsrelslsgrdlagflvdcsapqlnvkgmtvldaakklaapwpqikavvl
    kaennpalgkidiepgetvwqalthiansvglhpwlepdgtlvvggadyssppvatlcws
    rtdsrcniermdiewdtdnrfsevtflaqshghdlkwvykdptmtlhrpktvvvsdnlaa
    lqkqakkqladwrlegftltitvgghktrdgvlwqpglrvhviddehgidavfflmgrrf
    mlsrmdgtqtelrlkedgiwtpdayp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d37B (B:)
    mqnnsygyavsvrvggkehrhwerydidsdflipadsfdfvigrlgpeaaipdlsgesce
    vvidgqivmtgiigsqrhgkskgsrelslsgrdlagflvdcsapqlnvkgmtvldaakkl
    aapwpqikavvlkaennpalgkidiepgetvwqalthiansvglhpwlepdgtlvvggad
    yssppvatlcwsrtdsrcniermdiewdtdnrfsevtflaqshgrsgdsakhdlkwvykd
    ptmtlhrpktvvvsdadnlaalqkqakkqladwrlegftltitvgghktrdgvlwqpglr
    vhviddehgidavfflmgrrfmlsrmdgtqtelrlkedgiwtpdaypkkaeaarkrkgkr
    kgvshkgkkggkkqaetavfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d37B (B:)
    ygyavsvrvggkehrhwerydidsdflipadsfdfvipdlsgescevvidgqivmtgiig
    sqrhgkskgsrelslsgrdlagflvdcsapqlnvkgmtvldaakklaapwpqikavvlka
    ennpalgkidiepgetvwqalthiansvglhpwlepdgtlvvggadyssppvatlcwsrt
    dsrcniermdiewdtdnrfsevtfllkwvykdptmtlhrpktvvvdnlaalqkqakkqla
    dwrlegftltitvgghktrdgvlwqpglrvhviddehgidavfflmgrrfmlsrmdgtqt
    elrlkedgiwtpdayp