PDB entry 3d36

View 3d36 on RCSB PDB site
Description: How to Switch Off a Histidine Kinase: Crystal Structure of Geobacillus stearothermophilus KinB with the Inhibitor Sda
Class: Transferase/Transferase inhibitor
Keywords: GHKL ATPase, Four Helix Bundle, Class I Two-Component Histidine Kinase, Kinase, Phosphoprotein, Transferase, Two-component regulatory system, Transferase/Transferase inhibitor COMPLEX
Deposited on 2008-05-09, released 2009-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-03-10, with a file datestamp of 2009-03-06.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.201
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Sporulation kinase B
  Species: Geobacillus stearothermophilus [TaxId:272567]
  Gene: GK1832, GKA09
  Database cross-references and differences (RAF-indexed):
  • PDB 3D36 (0-End)
• Chain 'B':
  Compound: Sporulation kinase B
  Species: Geobacillus stearothermophilus [TaxId:272567]
  Gene: GK1832, GKA09
  Database cross-references and differences (RAF-indexed):
  • PDB 3D36 (0-End)
• Chain 'C':
  Compound: Sporulation kinase inhibitor Sda
  Species: Geobacillus stearothermophilus [TaxId:272567]
  Gene: GK2527
  Database cross-references and differences (RAF-indexed):
  • PDB 3D36 (0-End)
  Domains in SCOPe 2.08: d3d36c_
• Heterogens: MG, ADP, MPD, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >3d36C (C:)
  mkhlsdelliesyfkakelnlspefieliekeiqrrslthkiklss
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3d36C (C:)
  mkhlsdelliesyfkakelnlspefieliekeiqrrslthki