PDB entry 3d33

View 3d33 on RCSB PDB site
Description: crystal structure of a duf3244 family protein with an immunoglobulin- like beta-sandwich fold (bvu_0276) from bacteroides vulgatus atcc 8482 at 1.70 a resolution
Deposited on 2008-05-09, released 2008-05-27
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Domain of Unknown Function with an Immunoglobulin-like Beta-sandwich Fold
    Species: Bacteroides vulgatus ATCC 8482 [TaxId:435590]
    Gene: YP_001297618.1, BVU_0276
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Domain of Unknown Function with an Immunoglobulin-like Beta-sandwich Fold
    Species: Bacteroides vulgatus ATCC 8482 [TaxId:435590]
    Gene: YP_001297618.1, BVU_0276
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3d33A (A:)
ganttetpvkdveldgrwddpirsaatncpitvftdgylltlknaspdrdmtiritdmak
ggvvyendipevqsayitisianfpaeeykleitgtpsghltgyftke

    Sequence, based on observed residues (ATOM records):
    >3d33A (A:)
pvkdveldgrwddncpitvftdgylltlknaspdrdmtiritdmakggvvyendipevqs
ayitisianfpaeeykleitgtpsghltgyftke

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3d33B (B:)
ganttetpvkdveldgrwddpirsaatncpitvftdgylltlknaspdrdmtiritdmak
ggvvyendipevqsayitisianfpaeeykleitgtpsghltgyftke

    Sequence, based on observed residues (ATOM records):
    >3d33B (B:)
pvkdveldgrwdncpitvftdgylltlknaspdrdmtiritdmakggvvyendipevqsa
yitisianfpaeeykleitgtpsghltgyftke