PDB entry 3d32

View 3d32 on RCSB PDB site
Description: Complex of GABA(A) receptor-associated protein (GABARAP) with a synthetic peptide
Class: transport protein
Keywords: alpha-beta, beta-grasp fold, Cytoskeleton, Golgi apparatus, Membrane, Microtubule, Transport, TRANSPORT PROTEIN
Deposited on 2008-05-09, released 2008-08-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-03-04, with a file datestamp of 2020-02-28.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAP, FLC3B, HT004
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95166 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d3d32a2, d3d32a3
  • Chain 'B':
    Compound: Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAP, FLC3B, HT004
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3d32b_
  • Chain 'C':
    Compound: K1 peptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3D32 (0-End)
  • Chain 'D':
    Compound: K1 peptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3D32 (0-End)
  • Heterogens: NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d32A (A:)
    gsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvg
    qfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d32A (A:)
    gsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvg
    qfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvyg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d32B (B:)
    gsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvg
    qfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d32B (B:)
    mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
    yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvyg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.