PDB entry 3d30

View 3d30 on RCSB PDB site
Description: Structure of an expansin like protein from Bacillus Subtilis at 1.9A resolution
Deposited on 2008-05-09, released 2008-10-14
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.165
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Expansin like protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yoaJ, BSU18630
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34918 (1-207)
      • initiating methionine (0)
  • Heterogens: GOL, FMT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3d30A (A:)
    mayddlhegyatytgsgysggaflldpipsdmeitainpadlnyggvkaalagsyleveg
    pkgkttvyvtdlypegargaldlspnafrkignmkdgkinikwrvvkapitgnftyrike
    gssrwwaaiqvrnhkypvmkmeyekdgkwinmekmdynhfvstnlgtgslkvrmtdirgk
    vvkdtipklpesgtskaytvpghvqfpe