PDB entry 3d2w

View 3d2w on RCSB PDB site
Description: Crystal structure of mouse TDP-43 RRM2 domain in complex with DNA
Class: DNA/RNA binding protein
Keywords: DP-43 proteinopathy, TDP-43 inclusions, RNA recognition motif, FTLD-U, ALS, RRM, DNA-RNA BINDING PROTEIN COMPLEX
Deposited on 2008-05-09, released 2009-04-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-05-12, with a file datestamp of 2010-05-07.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.21
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TAR DNA-binding protein 43
    Species: Mus musculus [TaxId:10090]
    Gene: Tardbp, Tdp43
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q921F2 (12-End)
      • expression tag (10-11)
    Domains in SCOPe 2.07: d3d2wa1, d3d2wa2
  • Chain 'B':
    Compound: DNA (5'-d(*dgp*dtp*dtp*dgp*dap*dgp*dcp*dgp*dtp*dt)-3')
    Species: synthetic, synthetic
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d2wA (A:)
    mrgshhhhhhgskvfvgrctedmtaeelqqffcqygevvdvfipkpfrafafvtfaddkv
    aqslcgedliikgisvhisnaepkhnkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d2wA (A:)
    gskvfvgrctedmtaeelqqffcqygevvdvfipkpfrafafvtfaddkvaqslcgedli
    ikgisvhisnae
    

  • Chain 'B':
    No sequence available.