PDB entry 3d2t

View 3d2t on RCSB PDB site
Description: Human transthyretin (ttr) complexed with diflunisal
Class: hormone
Keywords: TTR, AMYLOID, TRANSTHYRETIN, Disease mutation, Gamma-carboxyglutamic acid, Glycoprotein, Hormone, Polyneuropathy, Retinol-binding, Secreted, Thyroid hormone, Transport, Vitamin A, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2008-05-08, released 2008-05-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.212
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3d2ta_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3d2tb_
  • Heterogens: 1FL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d2tA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d2tA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d2tB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d2tB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftanrytiaallspysysttavvt