PDB entry 3d2k

View 3d2k on RCSB PDB site
Description: Crystal structure of mouse Aurora A (Asn186->Gly, Lys240->Arg, Met302->Leu) in complex with [7-(2-{2-[3-(3-chloro-phenyl)-ureido]-thiazol-5-yl}-ethylamino)-pyrazolo[4,3-d]pyrimidin-1-yl]-acetic acid
Class: Transferase
Keywords: Aurora A, small-molecule inhibitor, Kinase, Transferase
Deposited on 2008-05-08, released 2009-05-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-05-12, with a file datestamp of 2009-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.223
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine kinase 6
    Species: Mus musculus [TaxId:10090]
    Gene: Aurka, Stk6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8C3H8
      • engineered (53)
      • engineered (107)
    Domains in SCOPe 2.04: d3d2ka_
  • Heterogens: AK4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d2kA (A:)
    gplgskrqwtledfdigrplgkgkfgnvylarerqskfilalkvlfktqlekagvehqlr
    reveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklsrfdeqrtatyite
    lanalsychskrvihrdikpenlllgsngelkiadfgwsvhapssrrttlcgtldylppe
    miegrmhdekvdlwslgvlcyeflvgmppfeahtyqetyrrisrveftfpdfvtegardl
    isrllkhnasqrltlaevlehpwikansskps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d2kA (A:)
    wtledfdigrplgkgkfgnvylarerqskfilalkvlfktqlekagvehqlrreveiqsh
    lrhpnilrlygyfhdatrvylileyaplgtvyrelqklsrfdeqrtatyitelanalsyc
    hskrvihrdikpenlllgsngelkiadfgwsvhtldylppemidekvdlwslgvlcyefl
    vgmppfeahtyqetyrrisrveftfpdfvtegardlisrllkhnasqrltlaevlehpwi
    kanss